1.67 Rating by CuteStat

chicopeekedikopekmamalari.com is 9 years 1 month old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, chicopeekedikopekmamalari.com is SAFE to browse.

PageSpeed Score
99
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

77.92.140.32

Hosted Country:

Türkiye TR

Location Latitude:

41.0214

Location Longitude:

28.9948

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 77.92.140.32)

Kötü Sözlük'tü.

- kotusozluk.com
4,085,720 $ 240.00

Tam Haber | Güncel Haberler ve Son Dakika Haberleri

- tamhaber.com.tr

Tüm sosyal medya, gazete ve internet haberleri, köşe yazarları, son dakika haberler ve halk için habercilik anlayışı ile Türkiye'nin gerçek haber sitesi.

7,102,027 $ 240.00

Maya Cupcake | Harika Cupcake Çeşitleri

- mayacupcake.com

Doğumgünü, düğün ve özel gün cupcake çeşitlerimiz ile karşınızdayız.

19,998,643 $ 8.95

Index of /

- tuvalettikanikligiacmafiyatlari.net
Not Applicable $ 8.95

Sultangazi Petek Temizliği | Bir başka WordPress sitesi

- sultangazipetektemizligi.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Content-Type: text/html;charset=ISO-8859-1
Server: - Web acceleration by http://www.unixy.net/varnish
X-Cacheable: YES
Cteonnt-Length: 203
Accept-Ranges: bytes
Date: Fri, 24 Apr 2015 13:33:22 GMT
X-Varnish: 1513110674
Via: 1.1 varnish
Connection: keep-alive
age: 0
X-Cache: MISS
Cache-Control: private
Content-Encoding: gzip
Content-Length: 170

Domain Information

Domain Registrar: FBS INC.
Registration Date: Mar 16, 2015, 12:00 AM 9 years 1 month 1 week ago
Last Modified: Mar 16, 2015, 12:00 AM 9 years 1 month 1 week ago
Expiration Date: Mar 16, 2016, 12:00 AM 8 years 1 month 2 weeks ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.kotuhost.com 212.68.61.245 Türkiye Türkiye
ns2.kotuhost.com 212.68.61.231 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
chicopeekedikopekmamalari.com A 14399 IP: 77.92.140.32
chicopeekedikopekmamalari.com NS 21599 Target: ns2.kotuhost.com
chicopeekedikopekmamalari.com NS 21599 Target: ns1.kotuhost.com
chicopeekedikopekmamalari.com SOA 21599 MNAME: ns1.kotuhost.com
RNAME: destek.labina.com.tr
Serial: 2015031603
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
chicopeekedikopekmamalari.com MX 14399 Target: chicopeekedikopekmamalari.com
chicopeekedikopekmamalari.com TXT 14399 TXT: v=spf1 +a +mx +ip4:77.92.140.32 ~all

Full WHOIS Lookup

Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

Domain Name: CHICOPEEKEDIKOPEKMAMALARI.COM
Registrar: FBS INC.
Sponsoring Registrar IANA ID: 1110
Whois Server: whois.isimtescil.net
Referral URL: http://www.isimtescil.net
Name Server: NS1.KOTUHOST.COM
Name Server: NS2.KOTUHOST.COM
Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Updated Date: 16-mar-2015
Creation Date: 16-mar-2015
Expiration Date: 16-mar-2016

>>> Last update of whois database: Fri, 24 Apr 2015 13:33:16 GMT